Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
50,343
results
| Purity or Quality Grade | >97% pure by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Molecular Weight (g/mol) | 33.4 kDa |
| Gene ID (Entrez) | 3919448 |
| Formulation | Lyophilized from additive free solution. |
| Research Category | Epitope Tags |
| Reconstitution | Dissolve in distilled water or saline. |
| Endotoxin Concentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity,HPLC |
| Protein | Protein A |
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 95.26 kDa |
| Gene ID (Entrez) | 7515 |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | XRCC1 |
| Research Category | Apoptosis, Base Excision Repair, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | XRCC1 |
| Purity or Quality Grade | >95%, by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1 |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 26.7 kDa |
| Gene ID (Entrez) | 997 |
| Formulation | A 0.2 μm filtered concentrated solution in 50 mM HEPES, pH 7.0, 125 mM NaCl, 10 % Glycerol, 1 mM DTT. |
| Gene Symbol | CDC34 |
| Research Category | Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers |
| Endotoxin Concentration | Less than 0.1 EU/μg of UBE2R1/CDC34 as determined by LAL method. |
| Storage Requirements | Store at -20°C. Avoid freeze/thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Protein | UBE2R1/CDC34 |
| Purity or Quality Grade | >95%, by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | CD258, CD258 antigen, delta transmembrane LIGHT, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, HVEM-L, HVEMLherpesvirus entry mediator-ligand, ligand for herpesvirus entry mediator, LIGHTherpesvirus entry mediator A, LTg, TR2, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand superfamily member 14, tumor necrosis factor receptor-like 2, tumor necrosis factor superfamily member LIGHT |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 18.4 kDa |
| Gene ID (Entrez) | 8740 |
| Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4. |
| Gene Symbol | TNFSF14 |
| Research Category | Apoptosis |
| Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.) |
| Endotoxin Concentration | Less than 1 EU/μg of LIGHT/TNFSF14 as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.) |
| For Use With (Application) | Western Blot,Bioactivity |
| Protein | LIGHT/TNFSF14 |
| Purity or Quality Grade | >98% pure by SDS-PAGE and HPLC |
|---|---|
| Molecular Weight (g/mol) | 16.9 kDa |
| Gene Symbol | IFNG |
| Endotoxin Concentration | Less than 1 EU/ug of IFN-gamma as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity |
| Protein | IFN-gamma |
| Accession Number | P01579 |
| Gene Alias | IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma |
| Gene ID (Entrez) | 3458 |
| Formulation | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
| Research Category | Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers |
| Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
| Purity or Quality Grade | >98% pure by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Molecular Weight (g/mol) | 33.5 kDa |
| Gene ID (Entrez) | 3919448 |
| Formulation | Lyophilized from additive free solution. |
| Research Category | Biologically Active Proteins, Epitope Tags |
| Reconstitution | Reconstitute with distilled water or saline. |
| Endotoxin Concentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity |
| Protein | Protein A |
| Accession Number | P21171 |
|---|---|
| Purity or Quality Grade | >90% SDS-PAGE |
| Gene Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Molecular Weight (g/mol) | M.W. Theoretical: 50 kDa |
| Formulation | Liquid. 0.2um-filtered solution in PBS, pH 7.2 |
| Research Category | Immunology |
| Endotoxin Concentration | <1 EU/μg purified protein (LAL test; Lonza). |
| Storage Requirements | Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5 mg/ml |
| For Use With (Application) | SDS-PAGE |
| Protein | Listeria monocytogenes p60 |
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | WDR5 |
| Molecular Weight (g/mol) | 38.8kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl. |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
Novus Biologicals™ gamma Tubulin Protein
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Novus Biologicals™ PMM2/Phosphomannomutase 2 Protein
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | PMM2/Phosphomannomutase 2 |
| Molecular Weight (g/mol) | 30.2kDa |
| Gene ID (Entrez) | 5373 |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl. |
| Immunogen | PMM2, 1-246 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | GALK1 |
| Molecular Weight (g/mol) | 44.4kDa |
| Gene ID (Entrez) | 2584 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT |
| Immunogen | MGSSHHHHHH SSGLVPRGSH MAALRQPQVA ELLAEARRAF REEFGAEPEL AVSAPGRVNL IGEHTDYNQG LVLPMALELM TVLVGSPRKD GLVSLLTTSE GADEPQRLQF PLPTAQRSLE PGTPRWANYV KGVIQYYPAA PLPGFSAVVV SSVPLGGGLS SSASLEVATY TFLQQLCPDS GTIAARAQVC QQAEHSFAGM PCGIMDQFIS LMGQKGHALL IDCRSLETSL VPLSDPKLAV LITNSNVRHS LASSEYPVRR RQCEEVARAL GKESLREVQL EELEAARDLV SKEGFRRARH VVGEIRRTAQ AAAALRRGDY RAFGRLMVES HRSLRDDYEV SCPELDQLVE AALAVPGVYG SRMTGGGFGG CTVTLLEASA APHAMRHIQE HYGGTATFYL SQAADGAKVL CL |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |