missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ PMM2/Phosphomannomutase 2 Protein

Product Code. 18234595 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
0.5 mg
Packungsgröße:
0.1mg
0.5mg
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18234595

Marke: Novus Biologicals™ NBP1486000.1MG

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-246 of Human PMM2/Phosphomannomutase 2 The Recombinant Human PMM2/Phosphomannomutase 2 Protein is derived from E. coli. The Recombinant Human PMM2/Phosphomannomutase 2 Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Spezifikation

Concentration 1mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Gene ID (Entrez) 5373
Molecular Weight (g/mol) 30.2kDa
Purification Method Protein
Quantity 0.1 mg
Source Human
Immunogen PMM2, 1-246 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name PMM2/Phosphomannomutase 2
Conjugate Unconjugated
Purity or Quality Grade >95%
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt