Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
19
results
Invitrogen™ DEGS1 Recombinant Rabbit Monoclonal Antibody (K01_1T94)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Maintain refrigerated at 2-8°C for up to 1 month. For long term storage store at -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | O15121 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | DEGS1 |
| Gene Symbols | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | AA536663; Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1 (Drosophila); degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte-like protein RDES; Degs; DEGS1; DEGS-1; delta 4-desaturase, sphingolipid 1; Delta(4)-desaturase; delta(4)-desaturase, sphingolipid 1; DES1; Des-1; dihydroceramide desaturase; dihydroceramide desaturase 1; dihydroceramide desaturase-1; DSH1; FADS7; fb81d06; hypothetical protein LOC507290; im:6909319; Mdes; membrane fatty acid (lipid) desaturase; membrane lipid desaturase; MGC5079; MIG15; migration-inducing gene 15 protein; MLD; sphingolipid 1; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; sphingolipid delta(4)-desaturase DES1; wu:fa25h01; wu:fb81d06 |
| Gene | DEGS1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8560 |
| Formulation | 50mM tris glycine with 0.05% BSA, 40% glycerol, 150mM NaCl and 0.01% sodium azide; pH 7.4 |
| Immunogen | A synthetic peptide of human MLD. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | K01_1T94 |
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
DEGS1 Recombinant Rabbit Monoclonal Antibody (23GB1215), Invitrogen™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | O15121 |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AA536663; Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1 (Drosophila); degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte-like protein RDES; Degs; DEGS1; DEGS-1; delta 4-desaturase, sphingolipid 1; Delta(4)-desaturase; delta(4)-desaturase, sphingolipid 1; DES1; Des-1; dihydroceramide desaturase; dihydroceramide desaturase 1; dihydroceramide desaturase-1; DSH1; FADS7; fb81d06; hypothetical protein LOC507290; im:6909319; Mdes; membrane fatty acid (lipid) desaturase; membrane lipid desaturase; MGC5079; MIG15; migration-inducing gene 15 protein; MLD; sphingolipid 1; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; sphingolipid delta(4)-desaturase DES1; wu:fa25h01; wu:fb81d06 |
| Gene | DEGS1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8560 |
| Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.4 |
| Immunogen | A synthesized peptide derived from human MLD (1-53AA). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 23GB1215 |
Invitrogen™ DEGS1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ DEGS1 Recombinant Rabbit Monoclonal Antibody (9D6X8)
Rabbit Recombinant Monoclonal Antibody
DEGS1, Mouse, Clone: 3F9, Abnova™
Mouse monoclonal antibody raised against a partial recombinant DEGS1.
DEGS1, Rabbit, Polyclonal Antibody, Abnova™
Rabbit polyclonal antibody raised against synthetic peptide of DEGS1.
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:1000-1:3000 |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 234-323 of human DEGS1 (NP_003667.1). YMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Ammonium sulfate precipitation |
| Dilution | Western Blot : 1-5 μg/mL |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | Phosphate buffered saline |
| Immunogen | Synthetic peptide derived from the human DEGS1 protein |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Concentration | 0.3 mg/mL |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA |
| Immunogen | A synthetic peptide of human DEGS1 (Uniprot # O15121) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S03-5D2 |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cardiovascular Biology, Endocrinology |
| Antigen | DEGS1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Gene Alias | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
| Gene ID (Entrez) | 8560 |
| Formulation | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DEGS1 (NP_003667.1).,, Sequence:, MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNC |
| Classification | Monoclonal |
| Primary or Secondary | Primary |