missing translation for 'onlineSavingsMsg'
Learn More

DEGS1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

£161.00 - £383.00

Specifications

Antigen	DEGS1
Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Applications	ELISA, Western Blot
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
30230909 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-33203-100ul	100 μL	£383.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

30228607 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-33203-20ul	20 μL	£161.00 20µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

DEGS1 Monoclonal antibody specifically detects DEGS1 in Human samples. It is validated for ELISA,Western Blot

Specifications

Antigen	DEGS1
Applications	ELISA, Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cancer, Cardiovascular Biology, Endocrinology
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene ID (Entrez)	8560
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DEGS1 (NP_003667.1).,, Sequence:, MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNC
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

DEGS1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents