accessibility menu, dialog, popup

UserName

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (7)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

running buffer

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (2)
  • (5)

Applications

  • (2)
  • (2)
  • (2)
  • (3)
  • (1)
  • (3)
  • (7)

Classification

  • (2)
  • (5)

Conjugate

  • (7)

Host Species

  • (5)
  • (2)

Quantity

  • (3)
  • (4)

Target Species

  • (2)
  • (2)
  • (2)
  • (1)
  • (6)
  • (6)
  • (1)
Show all

Regulatory Status

  • (6)

Form

  • (2)
  • (3)

Isotype

  • (3)
  • (2)
1 – 7 of 7 results
2

SNX29 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Antigen SNX29
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1.0 ug/ml
Gene Alias A-388D4.1, FLJ00143, FLJ12363, FLJ40609, RUN domain containing 2A, sorting nexin 29
Gene ID (Entrez) 92017
Formulation PBS buffer, 2% sucrose
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNX29. Peptide sequence AVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQ
Classification Polyclonal
Primary or Secondary Primary
3

RPIP8 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Research Discipline Signal Transduction
Antigen RPIP8
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1.0 ug/ml
Gene Alias Rap2-interacting protein 8, RAP2IPRUN domain-containing protein 3A, RPIP-8, RPIP8RaP2 interacting protein 8, RUN domain containing 3A
Gene ID (Entrez) 10900
Formulation PBS buffer, 2% sucrose
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse RPIP8 (NP_001239276.1). Peptide sequence LKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKM
Classification Polyclonal
Primary or Secondary Primary
4

Ahsa1, Rat, Clone: 25F2.D10, Abnova™

Rat monoclonal antibody raised against Ahsa1.

7

SNX29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Gene Accession No. NP_115543
Antigen SNX29
Gene Symbols SNX29
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias A-388D4.1, FLJ00143, FLJ12363, FLJ40609, RUN domain containing 2A, sorting nexin 29
Gene ID (Entrez) 92017
Immunogen Synthetic peptide directed towards the N terminal of human RUNDC2AThe immunogen for this antibody is RUNDC2A. Peptide sequence MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFE.
Classification Polyclonal
Primary or Secondary Primary