| Content And Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Target Species |
Human |
| Host Species |
Rabbit |
| Conjugate |
Unconjugated |
| Applications |
Western Blot,Immunocytochemistry |
| Form |
Purified |
| Isotype |
IgG |
| Research Discipline |
Zinc Finger |
| Antigen |
Ring finger protein 138 |
| Regulatory Status |
RUO |
| Purification Method |
Immunogen affinity purified |
| Dilution |
Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Gene Alias |
E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN |
| Gene ID (Entrez) |
51444 |
| Formulation |
PBS (pH 7.2) and 40% Glycerol |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR |
| Classification |
Polyclonal |
| Primary or Secondary |
Primary |