ring finger protein 8, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RNF8 protein.

Brand:  Abnova H00009025-B01.50uL

Product Code. 16199755

Description

The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF

Specifications

• Antigen: ring finger protein 8
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human RNF8 protein.
• Gene: RNF8
• Gene Alias: FLJ12013/KIAA0646
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_003958.2
• Gene Symbols: RNF8
• Immunogen: RNF8 (NP_003949.1, 1 a.a. ∼ 485 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9025
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.