XPD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18265504	Novus Biologicals NBP2-56327	100 μL
18605406	Novus Biologicals NBP2-56327-25ul	25 μL

Description

XPD Polyclonal specifically detects XPD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: XPD
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Gene Alias: Basic transcription factor 2 80 kDa subunit, BTF2 p80, COFS2, CXPD, DNA excision repair protein ERCC-2, DNA repair protein complementing XP-D cells, EC 3.6.1, EC 3.6.4.12, EM9TFIIH basal transcription factor complex 80 kDa subunit, excision repair cross-complementing rodent repair deficiency, complementationgroup 2, MAG, MGC102762, MGC126218, MGC126219, TFIIH 80 kDa subunit, TFIIH basal transcription factor complex helicase subunit, TFIIH basal transcription factor complex helicase XPD subunit, TTD, xeroderma pigmentosum complementary group D, Xeroderma pigmentosum group D-complementing protein, XPDC, XPDTFIIH p80
• Gene Symbols: ERCC2
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2068
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only