missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XPD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56327-25ul
This item is not returnable.
View return policy
Description
XPD Polyclonal specifically detects XPD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| XPD | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Basic transcription factor 2 80 kDa subunit, BTF2 p80, COFS2, CXPD, DNA excision repair protein ERCC-2, DNA repair protein complementing XP-D cells, EC 3.6.1, EC 3.6.4.12, EM9TFIIH basal transcription factor complex 80 kDa subunit, excision repair cross-complementing rodent repair deficiency, complementationgroup 2, MAG, MGC102762, MGC126218, MGC126219, TFIIH 80 kDa subunit, TFIIH basal transcription factor complex helicase subunit, TFIIH basal transcription factor complex helicase XPD subunit, TTD, xeroderma pigmentosum complementary group D, Xeroderma pigmentosum group D-complementing protein, XPDC, XPDTFIIH p80 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ERCC2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK | |
| 25 μL | |
| Cancer, DNA Repair, Nucleotide Excision Repair | |
| 2068 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction