XPD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56327

Product Code. 18265504

Description

XPD Polyclonal specifically detects XPD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: XPD
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Basic transcription factor 2 80 kDa subunit, BTF2 p80, COFS2, CXPD, DNA excision repair protein ERCC-2, DNA repair protein complementing XP-D cells, EC 3.6.1, EC 3.6.4.12, EM9TFIIH basal transcription factor complex 80 kDa subunit, excision repair cross-complementing rodent repair deficiency, complementationgroup 2, MAG, MGC102762, MGC126218, MGC126219, TFIIH 80 kDa subunit, TFIIH basal transcription factor complex helicase subunit, TFIIH basal transcription factor complex helicase XPD subunit, TTD, xeroderma pigmentosum complementary group D, Xeroderma pigmentosum group D-complementing protein, XPDC, XPDTFIIH p80
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ERCC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK
• Quantity: 100 μL
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Gene ID (Entrez): 2068
• Target Species: Human
• Isotype: IgG

For Research Use Only