missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM11 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £364.00
Specifications
| Antigen | TMEM11 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TMEM11 Polyclonal antibody specifically detects TMEM11 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| TMEM11 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Endocrinology, GPCR, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8834 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| C17orf35, chromosome 17 open reading frame 35, PM1putative receptor protein, PMI, Protein PM1, Protein PMI, transmembrane protein 11 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TMEM11 (NP_003867.1). MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title