TMEM11 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93465-0.02ml

Product Code. 18685790

Description

TMEM11 Polyclonal antibody specifically detects TMEM11 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: TMEM11
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
• Gene Alias: C17orf35, chromosome 17 open reading frame 35, PM1putative receptor protein, PMI, Protein PM1, Protein PMI, transmembrane protein 11
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TMEM11 (NP_003867.1). MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNC
• Quantity: 0.02 mL
• Research Discipline: Endocrinology, GPCR, Signal Transduction
• Gene ID (Entrez): 8834
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified