missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sodium Potassium ATPase Alpha 2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £366.00
Specifications
| Antigen | Sodium Potassium ATPase Alpha 2 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677541
|
Novus Biologicals
NBP2-94669-0.02ml |
0.02 mL |
£164.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18692771
|
Novus Biologicals
NBP2-94669-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Sodium Potassium ATPase Alpha 2 Polyclonal antibody specifically detects Sodium Potassium ATPase Alpha 2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Sodium Potassium ATPase Alpha 2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 477 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| alpha-A(+) catalytic polypeptide, ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide, ATPase, Na+/K+ transporting, alpha 2 polypeptide, EC 3.6.3, EC 3.6.3.9, KIAA0778, MGC59864, MHP2, migraine, hemiplegic 2, Na(+)/K(+) ATPase alpha-2 subunit, Na+/K+ ATPase, alpha-B polypeptide, Sodium pump subunit alpha-2, sodium/potassium-transporting ATPase alpha-2 chain, sodium/potassium-transporting ATPase subunit alpha-2, sodium-potassium ATPase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATP1A2 (NP_000693.1). MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title