Sodium Potassium ATPase Alpha 2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94669-0.02ml

Product Code. 18677541

Description

Sodium Potassium ATPase Alpha 2 Polyclonal antibody specifically detects Sodium Potassium ATPase Alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: Sodium Potassium ATPase Alpha 2
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:500
• Gene Alias: alpha-A(+) catalytic polypeptide, ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide, ATPase, Na+/K+ transporting, alpha 2 polypeptide, EC 3.6.3, EC 3.6.3.9, KIAA0778, MGC59864, MHP2, migraine, hemiplegic 2, Na(+)/K(+) ATPase alpha-2 subunit, Na+/K+ ATPase, alpha-B polypeptide, Sodium pump subunit alpha-2, sodium/potassium-transporting ATPase alpha-2 chain, sodium/potassium-transporting ATPase subunit alpha-2, sodium-potassium ATPase
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATP1A2 (NP_000693.1). MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL
• Quantity: 0.02 mL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 477
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified