missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNA Helicase A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £592.00
Specifications
| Antigen | RNA Helicase A |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18685388
|
Novus Biologicals
NBP2-56889-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18636728
|
Novus Biologicals
NBP2-56889 |
100 μg |
£592.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RNA Helicase A Polyclonal antibody specifically detects RNA Helicase A in Human samples. It is validated for Western BlotSpecifications
| RNA Helicase A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1660 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DDX9ATP-dependent RNA helicase A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin), DEAH (Asp-Glu-Ala-His) box polypeptide 9, DEAH box protein 9, EC 3.6.1, EC 3.6.1.15, EC 3.6.4.13, FLJ17406, leukophysin, LKP, NDH II, NDH2, NDHII, Nuclear DNA helicase II, RHA | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title