missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNA Helicase A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56889-25ul
This item is not returnable.
View return policy
Description
RNA Helicase A Polyclonal antibody specifically detects RNA Helicase A in Human samples. It is validated for Western Blot
Specifications
| RNA Helicase A | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL | |
| DDX9ATP-dependent RNA helicase A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin), DEAH (Asp-Glu-Ala-His) box polypeptide 9, DEAH box protein 9, EC 3.6.1, EC 3.6.1.15, EC 3.6.4.13, FLJ17406, leukophysin, LKP, NDH II, NDH2, NDHII, Nuclear DNA helicase II, RHA | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQ | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 1660 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction