missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLR2L Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£150.00 - £366.00
Specifications
| Antigen | POLR2L |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695371
|
Novus Biologicals
NBP2-93863-0.02ml |
0.02 mL |
£150.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653530
|
Novus Biologicals
NBP2-93863-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
POLR2L Polyclonal antibody specifically detects POLR2L in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| POLR2L | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.3), 50% glycerol | |
| 5441 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DNA-directed RNA polymerase III subunit L, DNA-directed RNA polymerases I, II, and III subunit RPABC5, EC 2.7.7.6, hRPB7.6, hsRPB10b, polymerase (RNA) II (DNA directed) polypeptide L (7.6kD), polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa, RBP10, RNA polymerase II 7.6 kDa subunit, RPABC5, RPB10, RPB10 homolog, RPB10beta, RPB7.6RNA polymerases I, II, and III subunit ABC5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title