POLR2L Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93863-0.02ml

Product Code. 18695371

Description

POLR2L Polyclonal antibody specifically detects POLR2L in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: POLR2L
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin
• Gene Alias: DNA-directed RNA polymerase III subunit L, DNA-directed RNA polymerases I, II, and III subunit RPABC5, EC 2.7.7.6, hRPB7.6, hsRPB10b, polymerase (RNA) II (DNA directed) polypeptide L (7.6kD), polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa, RBP10, RNA polymerase II 7.6 kDa subunit, RPABC5, RPB10, RPB10 homolog, RPB10beta, RPB7.6RNA polymerases I, II, and III subunit ABC5
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
• Quantity: 0.02 mL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 5441
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified