missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLR2L Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93863-0.1ml
This item is not returnable.
View return policy
Description
POLR2L Polyclonal antibody specifically detects POLR2L in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| POLR2L | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| DNA-directed RNA polymerase III subunit L, DNA-directed RNA polymerases I, II, and III subunit RPABC5, EC 2.7.7.6, hRPB7.6, hsRPB10b, polymerase (RNA) II (DNA directed) polypeptide L (7.6kD), polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa, RBP10, RNA polymerase II 7.6 kDa subunit, RPABC5, RPB10, RPB10 homolog, RPB10beta, RPB7.6RNA polymerases I, II, and III subunit ABC5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK | |
| 0.1 mL | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| 5441 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction