missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Mcl-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £353.00
Specifications
| Antigen | Mcl-1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18476841
|
Novus Biologicals
NBP1-90006 |
100 μL |
£353.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18430022
|
Novus Biologicals
NBP1-90006-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Mcl-1 Polyclonal antibody specifically detects Mcl-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Mcl-1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Signal Transduction, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol | |
| 4170 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| bcl2-L-3, BCL2L3MGC104264, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, induced myeloid leukemia cell differentiation protein Mcl-1, Mcl-1, mcl1/EAT, MCL1-ES, MCL1L, MCL1S, MGC1839, myeloid cell leukemia ES, myeloid cell leukemia sequence 1 (BCL2-related), TM | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title