Mcl-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90006-25ul

Product Code. 18430022

Description

Mcl-1 Polyclonal antibody specifically detects Mcl-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Mcl-1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: bcl2-L-3, BCL2L3MGC104264, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, induced myeloid leukemia cell differentiation protein Mcl-1, Mcl-1, mcl1/EAT, MCL1-ES, MCL1L, MCL1S, MGC1839, myeloid cell leukemia ES, myeloid cell leukemia sequence 1 (BCL2-related), TM
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Signal Transduction, Tumor Suppressors
• Gene ID (Entrez): 4170
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified