missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Mcl-1 Antibody, Novus Biologicals™

Mcl-1 Antibody, Novus Biologicals™

Product Code. 18476841 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18476841 100 μL 100µL
18430022 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18476841 Supplier Novus Biologicals Supplier No. NBP190006

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Mcl-1 Polyclonal antibody specifically detects Mcl-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Mcl-1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias bcl2-L-3, BCL2L3MGC104264, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, induced myeloid leukemia cell differentiation protein Mcl-1, Mcl-1, mcl1/EAT, MCL1-ES, MCL1L, MCL1S, MGC1839, myeloid cell leukemia ES, myeloid cell leukemia sequence 1 (BCL2-related), TM
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Purification Method Immunogen affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Signal Transduction, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 4170
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.