missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAP4K6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | MAP4K6 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18602938
|
Novus Biologicals
NBP2-49220-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18650878
|
Novus Biologicals
NBP2-49220 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MAP4K6 Polyclonal antibody specifically detects MAP4K6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MAP4K6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| MAP Kinase Signaling, Protein Kinase | |
| PBS (pH 7.2), 40% Glycerol | |
| 50488 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| B55, EC 2.7.11, GCK family kinase MiNK, hMINK, hMINKbeta, MAP4K6EC 2.7.11.1, MAPK/ERK kinase kinase kinase 6, MEK kinase kinase 6, MGC21111, MINKMEKKK 6, Misshapen/NIK-related kinase, misshapen-like kinase 1, misshapen-like kinase 1 (zebrafish), Mitogen-activated protein kinase kinase kinase kinase 6, serine/threonine protein kinase, YSK2, ZC3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title