MAP4K6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49220

Product Code. 18650878

Description

MAP4K6 Polyclonal antibody specifically detects MAP4K6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: MAP4K6
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: B55, EC 2.7.11, GCK family kinase MiNK, hMINK, hMINKbeta, MAP4K6EC 2.7.11.1, MAPK/ERK kinase kinase kinase 6, MEK kinase kinase 6, MGC21111, MINKMEKKK 6, Misshapen/NIK-related kinase, misshapen-like kinase 1, misshapen-like kinase 1 (zebrafish), Mitogen-activated protein kinase kinase kinase kinase 6, serine/threonine protein kinase, YSK2, ZC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHL
• Quantity: 0.1 mL
• Research Discipline: MAP Kinase Signaling, Protein Kinase
• Gene ID (Entrez): 50488
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified