missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ITCH/AIP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | ITCH/AIP4 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246162
|
Novus Biologicals
NBP2-55083 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624937
|
Novus Biologicals
NBP2-55083-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ITCH/AIP4 Polyclonal specifically detects ITCH/AIP4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| ITCH/AIP4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AIF4, AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)), atrophin-1 interacting protein 4, Atrophin-1-interacting protein 4, dJ468O1.1, EC 6.3.2, EC 6.3.2.-, Itch, itchy (mouse homolog) E3 ubiquitin protein ligase, itchy E3 ubiquitin protein ligase homolog (mouse), itchy homolog E3 ubiquitin protein ligase, NAPP1E3 ubiquitin-protein ligase Itchy homolog, NFE2-associated polypeptide 1, ubiquitin protein ligase ITCH | |
| ITCH | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 83737 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title