missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ITCH/AIP4 Polyclonal specifically detects ITCH/AIP4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | ITCH/AIP4 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:250 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | AIF4, AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)), atrophin-1 interacting protein 4, Atrophin-1-interacting protein 4, dJ468O1.1, EC 6.3.2, EC 6.3.2.-, Itch, itchy (mouse homolog) E3 ubiquitin protein ligase, itchy E3 ubiquitin protein ligase homolog (mouse), itchy homolog E3 ubiquitin protein ligase, NAPP1E3 ubiquitin-protein ligase Itchy homolog, NFE2-associated polypeptide 1, ubiquitin protein ligase ITCH |
| Gene Symbols | ITCH |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?