Hsp70 interacting protein HIP Antibody (CL3708), Novus Biologicals™

Mouse Monoclonal Antibody

Product Code	Brand	Quantity
18224573	Novus Biologicals NBP2-61615	100 μL
18649937	Novus Biologicals NBP2-61615-25ul	25 μL

Description

Hsp70 interacting protein HIP Monoclonal specifically detects Hsp70 interacting protein HIP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Hsp70 interacting protein HIP
• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Host Species: Mouse
• Target Species: Human
• Gene ID (Entrez): 6767
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Clone: CL3708
• Classification: Monoclonal
• Form: Purified
• Research Discipline: Membrane Trafficking and Chaperones
• Gene Alias: AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein
• Gene Symbols: ST13
• Isotype: IgG1
• Purification Method: Protein A purified