Hsp70 interacting protein HIP Antibody (CL3708), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-61615

Product Code. 18224573

Description

Hsp70 interacting protein HIP Monoclonal specifically detects Hsp70 interacting protein HIP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Hsp70 interacting protein HIP
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ST13
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry
• Clone: CL3708
• Dilution: Western Blot 1 ug/ml, Immunohistochemistry 1:10000 - 1:20000
• Gene Alias: AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein
• Host Species: Mouse
• Purification Method: Protein A purified
• Research Discipline: Membrane Trafficking and Chaperones
• Gene ID (Entrez): 6767
• Target Species: Human
• Form: Purified