missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DOA Antibody [Unconjugated], Novus Biologicals™
Rabbit Polyclonal Antibody
£321.00 - £503.00
Specifications
| Antigen | HLA DOA |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30279225
|
Novus Biologicals
NBP3-43684-100ul |
100 μL |
£503.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30279472
|
Novus Biologicals
NBP3-43684-25ul |
25 μL |
£321.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HLA DOA Polyclonal antibody specifically detects HLA DOA in Human samples. It is validated for Immunohistochemistry,Immunohistochemistry (Paraffin)Specifications
| HLA DOA | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Asthma, Diabetes Research, Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 3111 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| HLA class II histocompatibility antigen, DO alpha chain, HLA-D0-alpha, HLA-DNAHLADZ, HLA-DZA, lymphocyte antigen, major histocompatibility complex, class II, DN alpha, major histocompatibility complex, class II, DO alpha, MHC class II antigen DOA, MHC DN-alpha, MHC DZ alpha | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title