missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DOA Antibody [Unconjugated], Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-43684-100ul
This item is not returnable.
View return policy
Description
HLA DOA Polyclonal antibody specifically detects HLA DOA in Human samples. It is validated for Immunohistochemistry,Immunohistochemistry (Paraffin)
Specifications
| HLA DOA | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| HLA class II histocompatibility antigen, DO alpha chain, HLA-D0-alpha, HLA-DNAHLADZ, HLA-DZA, lymphocyte antigen, major histocompatibility complex, class II, DN alpha, major histocompatibility complex, class II, DO alpha, MHC class II antigen DOA, MHC DN-alpha, MHC DZ alpha | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF | |
| 100 μL | |
| Asthma, Diabetes Research, Immunology | |
| 3111 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction