missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GNAL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | GNAL |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18692817
|
Novus Biologicals
NBP2-68695-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646717
|
Novus Biologicals
NBP2-68695 |
100 μg |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GNAL Polyclonal antibody specifically detects GNAL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| GNAL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2774 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Adenylate cyclase-stimulating G alpha protein, olfactory type, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory typ, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory type, guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide, olfactory type, guanine nucleotide-binding protein G(olf) subunit alpha | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title