GNAL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68695-25ul

Product Code. 18692817

Description

GNAL Polyclonal antibody specifically detects GNAL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: GNAL
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Adenylate cyclase-stimulating G alpha protein, olfactory type, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory typ, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory type, guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide, olfactory type, guanine nucleotide-binding protein G(olf) subunit alpha
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 2774
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified