missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Knockout-Validated-NBP3-15362-img0001.jpg-650.jpg)
-Western-Blot-NBP3-15362-img0002.jpg-650.jpg)
Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Clone: 7O4Q9, Novus Biologicals™
Rabbit Monoclonal Antibody
£158.00 - £386.00
Specifications
| Antigen | Glutathione Peroxidase 4/GPX4 |
|---|---|
| Clone | 7O4Q9 |
| Dilution | Western Blot 1:500 - 1:1000, Knockdown Validated |
| Applications | Western Blot, KnockDown |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18383554
|
Novus Biologicals
NBP3-15362-20UL |
20 μg |
£158.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18385505
|
Novus Biologicals
NBP3-15362-100UL |
100 μg |
£386.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glutathione Peroxidase 4/GPX4 Monoclonal antibody specifically detects Glutathione Peroxidase 4/GPX4 in Human, Mouse, Rat samples. It is validated for Western Blot, KnockDownSpecifications
| Glutathione Peroxidase 4/GPX4 | |
| Western Blot 1:500 - 1:1000, Knockdown Validated | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 7O4Q9 | |
| Western Blot, KnockDown | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 2879 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title