missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Clone: 7O4Q9, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Glutathione Peroxidase 4/GPX4 Monoclonal antibody specifically detects Glutathione Peroxidase 4/GPX4 in Human, Mouse, Rat samples. It is validated for Western Blot, KnockDown
Specifications
Specifications
| Antigen | Glutathione Peroxidase 4/GPX4 |
| Applications | Western Blot, KnockDown |
| Classification | Monoclonal |
| Clone | 7O4Q9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Knockdown Validated |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?