Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Clone: 7O4Q9, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-15362-100UL

Product Code. 18385505

Description

Glutathione Peroxidase 4/GPX4 Monoclonal antibody specifically detects Glutathione Peroxidase 4/GPX4 in Human, Mouse, Rat samples. It is validated for Western Blot, KnockDown

Specifications

• Antigen: Glutathione Peroxidase 4/GPX4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, KnockDown
• Clone: 7O4Q9
• Dilution: Western Blot 1:500 - 1:1000, Knockdown Validated
• Gene Alias: EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF
• Quantity: 100 μg
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 2879
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG