missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutathione Peroxidase 4/GPX4 Rabbit anti-Human, Mouse, Rat, Clone: 7O4Q9, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-15362-20UL
This item is not returnable.
View return policy
Description
Glutathione Peroxidase 4/GPX4 Monoclonal antibody specifically detects Glutathione Peroxidase 4/GPX4 in Human, Mouse, Rat samples. It is validated for Western Blot, KnockDown
Specifications
| Glutathione Peroxidase 4/GPX4 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, KnockDown | |
| 7O4Q9 | |
| Western Blot 1:500 - 1:1000, Knockdown Validated | |
| EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glutathione Peroxidase 4/GPX4 (P36969). MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF | |
| 20 μg | |
| Cancer, Endocrinology, Signal Transduction | |
| 2879 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction