missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G3BP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £452.00
Specifications
| Antigen | G3BP2 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18407010
|
Novus Biologicals
NBP1-82976-25ul |
25 μL |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18700394
|
Novus Biologicals
NBP1-82976 |
0.1 mL |
£452.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
G3BP2 Polyclonal antibody specifically detects G3BP2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| G3BP2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Immunoprecipitation | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| G3BP-2, GAP SH3 domain-binding protein 2, GTPase activating protein (SH3 domain) binding protein 2, KIAA0660, ras GTPase-activating protein-binding protein 2, Ras-GTPase activating protein SH3 domain-binding protein 2 | |
| G3BP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human sG3BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9908 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title