G3BP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-82976-25ul

Product Code. 18407010

Description

G3BP2 Polyclonal antibody specifically detects G3BP2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: G3BP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: G3BP-2, GAP SH3 domain-binding protein 2, GTPase activating protein (SH3 domain) binding protein 2, KIAA0660, ras GTPase-activating protein-binding protein 2, Ras-GTPase activating protein SH3 domain-binding protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human sG3BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Immunoprecipitation
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: G3BP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9908
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only