missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FKBP12.6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£177.00 - £366.00
Specifications
| Antigen | FKBP12.6 |
|---|---|
| Dilution | Western Blot 1:500-1:1000, Immunocytochemistry/ Immunofluorescence 1:20-1:50 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18687701
|
Novus Biologicals
NBP2-93037-0.02ml |
0.02 mL |
£177.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18611681
|
Novus Biologicals
NBP2-93037-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FKBP12.6 Polyclonal antibody specifically detects FKBP12.6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| FKBP12.6 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| mTOR Pathway, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 2281 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:1000, Immunocytochemistry/ Immunofluorescence 1:20-1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 12.6 kDa FK506-binding protein, calstabin 2,12.6 kDa FKBP, EC 5.2.1.8, FK506 binding protein 1B, 12.6 kDa, FK506-binding protein 12.6, FK506-binding protein 1B, FK506-binding protein 1B (12.6 kD), FKBP-12.6, FKBP12.6h-FKBP-12, FKBP-1B, FKBP1L, FKBP9, Immunophilin FKBP12.6, OTK4PPIase FKBP1B, peptidyl-prolyl cis-trans isomerase FKBP1B, PKBP1L, PPIase, Rotamase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP12.6 (NP_473374.1). MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title