missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FKBP12.6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93037-0.02ml
This item is not returnable.
View return policy
Description
FKBP12.6 Polyclonal antibody specifically detects FKBP12.6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| FKBP12.6 | |
| Polyclonal | |
| Western Blot 1:500-1:1000, Immunocytochemistry/ Immunofluorescence 1:20-1:50 | |
| 12.6 kDa FK506-binding protein, calstabin 2,12.6 kDa FKBP, EC 5.2.1.8, FK506 binding protein 1B, 12.6 kDa, FK506-binding protein 12.6, FK506-binding protein 1B, FK506-binding protein 1B (12.6 kD), FKBP-12.6, FKBP12.6h-FKBP-12, FKBP-1B, FKBP1L, FKBP9, Immunophilin FKBP12.6, OTK4PPIase FKBP1B, peptidyl-prolyl cis-trans isomerase FKBP1B, PKBP1L, PPIase, Rotamase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP12.6 (NP_473374.1). MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC | |
| 0.02 mL | |
| mTOR Pathway, Stem Cell Markers | |
| 2281 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction