FKBP12.6 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93037-0.1ml

Product Code. 18611681

Description

FKBP12.6 Polyclonal antibody specifically detects FKBP12.6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: FKBP12.6
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:1000, Immunocytochemistry/ Immunofluorescence 1:20-1:50
• Gene Alias: 12.6 kDa FK506-binding protein, calstabin 2,12.6 kDa FKBP, EC 5.2.1.8, FK506 binding protein 1B, 12.6 kDa, FK506-binding protein 12.6, FK506-binding protein 1B, FK506-binding protein 1B (12.6 kD), FKBP-12.6, FKBP12.6h-FKBP-12, FKBP-1B, FKBP1L, FKBP9, Immunophilin FKBP12.6, OTK4PPIase FKBP1B, peptidyl-prolyl cis-trans isomerase FKBP1B, PKBP1L, PPIase, Rotamase
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP12.6 (NP_473374.1). MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
• Quantity: 0.1 mL
• Research Discipline: mTOR Pathway, Stem Cell Markers
• Gene ID (Entrez): 2281
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified