missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin D3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£177.00 - £368.00
Specifications
| Antigen | Cyclin D3 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Knockout Validated |
| Applications | Western Blot, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18600562
|
Novus Biologicals
NBP2-92937-0.02ml |
0.02 mL |
£177.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669391
|
Novus Biologicals
NBP2-92937-0.1ml |
0.1 mL |
£368.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cyclin D3 Polyclonal antibody specifically detects Cyclin D3 in Human, Mouse samples. It is validated for Western Blot, Gene Knock-OutSpecifications
| Cyclin D3 | |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Wnt Signaling Pathway | |
| PBS with 50% glycerol, pH7.3. | |
| 896 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Knockout Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| cyclin D3, D3-type cyclin, G1/S-specific cyclin D3, G1/S-specific cyclin-D3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 201-292 of human Cyclin D3 (NP_001751.1). SMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title