missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin D3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92937-0.02ml
This item is not returnable.
View return policy
Description
Cyclin D3 Polyclonal antibody specifically detects Cyclin D3 in Human, Mouse samples. It is validated for Western Blot, Gene Knock-Out
Specifications
| Cyclin D3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Knockout Validated | |
| cyclin D3, D3-type cyclin, G1/S-specific cyclin D3, G1/S-specific cyclin-D3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 201-292 of human Cyclin D3 (NP_001751.1). SMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL | |
| 0.02 mL | |
| Cancer, Cell Cycle and Replication, Wnt Signaling Pathway | |
| 896 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction