Cyclin D3 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92937-0.1ml

Product Code. 18669391

Description

Cyclin D3 Polyclonal antibody specifically detects Cyclin D3 in Human, Mouse samples. It is validated for Western Blot, Gene Knock-Out

Specifications

• Antigen: Cyclin D3
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, Knockout Validated
• Gene Alias: cyclin D3, D3-type cyclin, G1/S-specific cyclin D3, G1/S-specific cyclin-D3
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-292 of human Cyclin D3 (NP_001751.1). SMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Cycle and Replication, Wnt Signaling Pathway
• Gene ID (Entrez): 896
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Gene Knock-Out
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified