missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD23/Fc epsilon RII Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£343.00 - £557.00
Specifications
| Antigen | CD23/Fc epsilon RII |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18349875
|
Novus Biologicals
NBP3-16985-25UL |
25 μg |
£343.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18352842
|
Bio-Techne
NBP3-16985-100UL |
100 μg |
£557.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD23/Fc epsilon RII Polyclonal antibody specifically detects CD23/Fc epsilon RII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CD23/Fc epsilon RII | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, B Cell Development and Differentiation Markers, Biologically Active Proteins, Cancer, Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 2208 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BLAST-2, CD23A, CD23CD23 antigen, CLEC4JC-type lectin domain family 4 member J, C-type lectin domain family 4, member J, Fc fragment of IgE, low affinity II, receptor for (CD23), FCE2Fc fragment of IgE, low affinity II, receptor for (CD23A), fc-epsilon-RII, IGEBF, Immunoglobulin E-binding factor, low affinity immunoglobulin epsilon Fc receptor, Lymphocyte IgE receptor | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title