missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD23/Fc epsilon RII Rabbit anti-Human, Polyclonal, Novus Biologicals™

CD23/Fc epsilon RII Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18349875 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18349875 25 μg 25µL
18352842 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18349875 Supplier Novus Biologicals Supplier No. NBP31698525UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CD23/Fc epsilon RII Polyclonal antibody specifically detects CD23/Fc epsilon RII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD23/Fc epsilon RII
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias BLAST-2, CD23A, CD23CD23 antigen, CLEC4JC-type lectin domain family 4 member J, C-type lectin domain family 4, member J, Fc fragment of IgE, low affinity II, receptor for (CD23), FCE2Fc fragment of IgE, low affinity II, receptor for (CD23A), fc-epsilon-RII, IGEBF, Immunoglobulin E-binding factor, low affinity immunoglobulin epsilon Fc receptor, Lymphocyte IgE receptor
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Adaptive Immunity, B Cell Development and Differentiation Markers, Biologically Active Proteins, Cancer, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 2208
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.