CD23/Fc epsilon RII Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-16985-100UL

Product Code. 18352842

Description

CD23/Fc epsilon RII Polyclonal antibody specifically detects CD23/Fc epsilon RII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CD23/Fc epsilon RII
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: BLAST-2, CD23A, CD23CD23 antigen, CLEC4JC-type lectin domain family 4 member J, C-type lectin domain family 4, member J, Fc fragment of IgE, low affinity II, receptor for (CD23), FCE2Fc fragment of IgE, low affinity II, receptor for (CD23A), fc-epsilon-RII, IGEBF, Immunoglobulin E-binding factor, low affinity immunoglobulin epsilon Fc receptor, Lymphocyte IgE receptor
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
• Quantity: 100 μg
• Research Discipline: Adaptive Immunity, B Cell Development and Differentiation Markers, Biologically Active Proteins, Cancer, Immunology
• Gene ID (Entrez): 2208
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified