missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD163 Antibody (CL10652), Novus Biologicals™
Mouse Monoclonal Antibody
£231.00 - £533.00
Specifications
| Antigen | CD163 |
|---|---|
| Clone | CL10652 |
| Dilution | Western Blot 1 μg/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18699757
|
Novus Biologicals
NBP3-07981-100ul |
100 μg |
£533.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18682789
|
Novus Biologicals
NBP3-07981-25ul |
25 μg |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD163 Monoclonal antibody specifically detects CD163 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CD163 | |
| Western Blot 1 μg/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| CD_antigen: CD163, CD163, CD163 molecule, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, Soluble CD163 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| CL10652 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Angiogenesis, Immune System Diseases, Immunology, Inflammation, Innate Immunity | |
| PBS, pH 7.2, containing 40% glycerol | |
| 9332 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title