missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD163 Antibody (CL10652), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP3-07981-25ul
This item is not returnable.
View return policy
Description
CD163 Monoclonal antibody specifically detects CD163 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CD163 | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL10652 | |
| Western Blot 1 μg/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CD_antigen: CD163, CD163, CD163 molecule, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, Soluble CD163 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD | |
| 25 μg | |
| Angiogenesis, Immune System Diseases, Immunology, Inflammation, Innate Immunity | |
| 9332 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction