missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-12A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Aquaporin-12A |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18274630
|
Novus Biologicals
NBP2-54696 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18621408
|
Novus Biologicals
NBP2-54696-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aquaporin-12A Polyclonal specifically detects Aquaporin-12A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Aquaporin-12A | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 375318 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AQP-12, AQP12AQPX2aquaporin X2, aquaporin 12, aquaporin 12A, aquaporin-12A | |
| AQP12A | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title