missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-12A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54696
This item is not returnable.
View return policy
Description
Aquaporin-12A Polyclonal specifically detects Aquaporin-12A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Aquaporin-12A | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| AQP-12, AQP12AQPX2aquaporin X2, aquaporin 12, aquaporin 12A, aquaporin-12A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 375318 | |
| Human | |
| IgG |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| AQP12A | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction